Наследование групп крови резус (12504)

Посмотреть архив целиком

Наследование групп крови резус

На рисунке представлено положение резус белка резус в мембране эритроцитов.



Почему он так назван? В 30-40-х годах, когда довольно интенсивно проводились исследования групп крови, было обнаружено, что антитела к группе крови мартышки резус агглютинируют у некоторых людей их эритроциты.

Агглютинация – это процесс склеивания эритроцитов под действием антител к белам, расположенным на мембранах эритроцитов. На рисунке ниже представлен картина агглютинации. Здесь изображены капельки крови , к которым добавлена сыворотка, содержащая антитела к резус-белку. Синим обведены капли, в которых с кровью ничего не происходит. Если реакция при добавлении антител не идет, то, значит у данного человека резус-белок отсутствует. Красным обведены образцы крови, в которых происходит агглютинация. Буквами помечены капли крови, которые реакцию дают, но очень слабую. Такое встречается у приблизительно 1% людей, и это так и называемый слабый резус фенотип.



С чем это связано? На рисунке ниже буквами представлена последовательность резус-белка. Вы знаете, что белок состоит из 20 аминокислот, каждая из которых обозначается своей буквой. Ген (последовательность нуклеотидов, соответственно, в 3 раза более длинная последовательность, записанная только четыремя буквами, а не 20), который кодирует резус-белок, называется RHD.

АМИНОКИСЛОТНАЯ ПОСЛЕДОВАТЕЛЬНОСТЬ РЕЗУС-БЕЛКА ЧЕЛОВЕКА

(каждая аминокислота обозначена одной буквой):

Информация из базы данных NCBI

Human RhD blood group antigen mRNA, complete cds

ORGANISM Homo sapiens

standard_name="RhD"

MSSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQV

GQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALGVQWAILLDGFLSQ

FP SGKVVITLFSIRLATMSALSVLISVDAVLGKVNLAQLVVMVLVEVTA

LGNLRMVISNIFNTDYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKD

QTATIPSLSAMLGALFLWMFWPSFNSALLRSPIERKNAVFNTYYAVAVSV

VTAISGSSLAHPQGKISKTYVHSAVLAGGVAVGTSCHLIPSPWLAMVLGL

VAGLISVGGAKYLPGCCNRVLGIPHSSIMGYNFSLLGLLGEIIYIVLLVL

DTVGAGNGMIGFQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHEA

KYFDDQVFWKFPHLAVGF

ПОСЛЕДОВАТЕЛЬНОСТЬ НУКЛЕОТИДОВ КОДИРУЮЩЕЙ ЧАСТИ ГЕНА РЕЗУС-БЕЛКА ЧЕЛОВЕКА

Информация из базы данных NCBI

1

atgagctcta

agtacccgcg

gtctgtccgg

cgctgcctgc

ccctctgggc

cctaacactg

61

gaagcagctc

tcattctcct

cttctatttt

tttacccact

atgacgcttc

cttagaggat

121

caaaaggggc

tcgtggcatc

ctatcaagtt

ggccaagatc

tgaccgtgat

ggcggccatt

181

ggcttgggct

tcctcacctc

gagtttccgg

agacacagct

ggagcagtgt

ggccttcaac

241

ctcttcatgc

tggcgcttgg

tgtgcagtgg

gcaatcctgc

tggacggctt

cctgagccag

301

ttcccttctg

ggaaggtggt

catcacactg

ttcagtattc

ggctggccac

catgagtgct

361

ttgtcggtgc

tgatctcagt

ggatgctgtc

ttggggaagg

tcaacttggc

gcagttggtg

421

gtgatggtgc

tggtggaggt

gacagcttta

ggcaacctga

ggatggtcat

cagtaatatc

481

ttcaacacag

actaccacat

gaacatgatg

cacatctacg

tgttcgcagc

ctattttggg

541

ctgtctgtgg

cctggtgcct

gccaaagcct

ctacccgagg

gaacggagga

taaagatcag

601

acagcaacga

tacccagttt

gtctgccatg

ctgggcgccc

tcttcttgtg

gatgttctgg

661

ccaagtttca

actctgctct

gctgagaagt

ccaatcgaaa

ggaagaatgc

cgtgttcaac

721

acctactatg

ctgtagcagt

cagcgtggtg

acagccatct

cagggtcatc

cttggctcac

781

ccccaaggga

agatcagcaa

gacttatgtg

cacagtgcgg

tgttggcagg

aggcgtggct

841

gtgggtacct

cgtgtcacct

gatcccttct

ccgtggcttg

ccatggtgct

gggtcttgtg

901

gctgggctga

tctccgtcgg

gggagccaag

tacctgccgg

ggtgttgtaa

ccgagtgctg

961

gggattcccc

acagctccat

catgggctac

aacttcagct

tgctgggtct

gcttggagag

1021

atcatctaca

ttgtgttgct

ggtgcttgat

accgtcggag

ccggcaatgg

catgattggc

1081

ttccaggtcc

tcctcagcat

tggggaactc

agcttggcca

tcgtgatagc

tctcacgtct

1141

ggtctcctga

caggtttgct

cctaaatctt

aaaatatgga

aagcacctca

tgaggctaaa

1201

tattttgatg

accaagtttt

ctggaagttt

cctcatttgg

ctgttggatt

ttaagcaaaa

1261

gcatccaaga

aaaacaaggc

ctgttcaaaa

acaagacaac

ttcctctcac

tgttgcctgc

1321

atttgtacgt

gagaaacgct

catgacagca

aagt//

У большинства людей (85%) имеется ген резус-фактора, но у 15% этот ген отсутствует, отсутствует соответствующий гену нуклеотидный "текст" . Если этот ген присутствует, то он определяет у человека синтез резус-белка. Если же его нет, то резус-белок не синтезируется.

Такие разные "состояния" гена – вариации нуклеотидного "текста" называются альтернативными формами или коротко –аллелями. В данном случае вариация – это наличие или отсутствие всей нуклеотидной последовательности гена.

У человека может встречаться 3 варианта сочетания резус-аллелей. Человек, у которого 2 аллеля с присутствующим геном, имеет группу крови резус положительную (рис. 4 вверху). Если у человека на одной из хромосом ген отсутствует, то белок все равно синтезируется с гена на другой хромосоме; и резус-группа также положительная (рис. в середине). Белок не синтезируется только в том случае, когда ген отсутствует на обоих хромосомах. Только в этом случае группа крови резус-отрицательная (рис. 4 внизу).



Вопрос, который был задан, описывал ситуацию, когда оба родителя имеют два разных аллеля. То есть оба они резус-положительны, но второй аллель у них не содержит последовательность, кодирующую резус-белок. И оба их ребенка получили от каждого из родителей как раз этот аллель с отсутствующим геном. Несложно рассчитать вероятность рождения в такой семье ребенка с отрицательным резус-фактором. Она равна 25% (1/2*1/2=1/4); вероятность же рождения обоих детей с резус-отрицательной группой крови – 1/16.

Стоит упомянуть о резус-конфликте. Его суть заключается в следующем. Если мать резус-отрицательна, ее муж резус-положительный, и ребенок наследует от отца Rh+, то в крови матери могут начать вырабатываться антитела против резус-фактора плода. При первой беременности этого обычно не происходит, но при родах возможен контакт с белками крови ребенка, и у матери могут появиться в крови антитела к резус-фактору. Тогда при следующей беременности резус-положительным плодом материнские антитела разрушат эритроциты ребенка. Это заболевание называется гемолитическая желтуха (ребенок рождается весь желтый и обычно вскоре умирает). Описано это заболевание впервые в 1609 году французской акушеркой. Когда была разработана процедура переливания крови, то таких детей научились спасать. Им делали заменное переливание крови, т.е. полностью сливали всю их кровь, и вводили новую. Теперь, когда установлены причины резус-конфликта, поступают следующим образом. Если во время беременности, у женщины кровь резус-отрицательна, а у мужа резус-положительна, следят за уровнем антител к резус-фактору и проводят необходимое лечение, если титр этих антител начинает возрастать. Стоит отметить, что если мать резус-положительна, а сам ребенок резус-отрицателен, то конфликта не происходит.

Я бы хотела отметить один из полученных ответов на этот вопрос. Когда мы составляли вопросы для лекций, мы получили реальный вопрос из газеты «АиФ» с просьбой разъяснить, в чем дело. Мы решили включить этот вопрос в опросник, с целью проверить, насколько наши слушателе знакомы с генетикой. Собственно, вопрос предполагался как чисто учебный. И вот один из ответов был следующим: «Я бы не рискнул отвечать на этот вопрос, так как я не специалист, а от моего ответа зависит семейное счастье человека». Хочется выразить уважение человеку, который так ответил на вопрос, потому что он воспринял контекст, в котором стояла чисто учебная задача. Он продемонстрировал понимание этических аспектов, связанных с наукой. Я думаю, вы понимаете, что существует ответственность ученого, и замечательно, что в вашей аудитории есть люди, которые уже сейчас настолько ясно понимают связь науки с реальной жизнью.


Случайные файлы

Файл
148225.rtf
17637.rtf
tabl.doc
38860.rtf
73805-1.rtf




Чтобы не видеть здесь видео-рекламу достаточно стать зарегистрированным пользователем.
Чтобы не видеть никакую рекламу на сайте, нужно стать VIP-пользователем.
Это можно сделать совершенно бесплатно. Читайте подробности тут.